RetrogeneDB ID: | retro_eeur_454 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_309999:10450..10890(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPF2 | ||
| Ensembl ID: | ENSEEUG00000006169 | ||
| Aliases: | None | ||
| Description: | ribosome production factor 2 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:20870] |
| Percent Identity: | 85.43 % |
| Parental protein coverage: | 50.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RRLKNLLIDFFRGPTVPNIRLAGLDYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVVR |
| R.LKNLLIDFFRGPTVPNI.LAGLDYVLHFTALN.KIYF.SYK.LL.KSGCRTP.IELEEM.PSL.LV.. | |
| Retrocopy | RTLKNLLIDFFRGPTVPNIHLAGLDYVLHFTALNRKIYF*SYK-LLNKSGCRTPQIELEEMRPSLQLVL- |
| Parental | RTHLASDDLYKLSMKMPKALKPKKRKNISQDTFGTTYGRIHMQKQDLSKLQTRKMK-GLKKRPAERITED |
| RTHLASDDLYKLSM.MPKALKP.KRKNIS.DTF.TTY..IHMQKQDLSKLQTRKMK.GLKK.PAERITED | |
| Retrocopy | RTHLASDDLYKLSMTMPKALKP-KRKNISPDTFVTTYVSIHMQKQDLSKLQTRKMK<GLKKHPAERITED |
| Parental | QENKPKRIKNN |
| .ENK.KR.KNN | |
| Retrocopy | KENKSKRVKNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .32 RPM | 11 .12 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .44 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .59 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003918 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005212 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000006797 | 2 retrocopies | |
| Equus caballus | ENSECAG00000017121 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006169 | 2 retrocopies |
retro_eeur_454 , retro_eeur_584,
|
| Felis catus | ENSFCAG00000001527 | 1 retrocopy | |
| Homo sapiens | ENSG00000197498 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001469 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005676 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021532 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000038510 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012854 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016028 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016925 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000018503 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000587 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017151 | 9 retrocopies |