RetrogeneDB ID: | retro_eeur_470 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_316590:21460..21810(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DESI2 | ||
Ensembl ID: | ENSEEUG00000009507 | ||
Aliases: | None | ||
Description: | desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:24264] |
Percent Identity: | 81.97 % |
Parental protein coverage: | 75.5 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 7 |
Parental | GGHPYPF-SGISDISPGNASELGETFKF-EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYH-LMHKNCNH |
GGHPYPF.SGI..ISPGNASELGETFKF.EAVVLGS.DFLEDDIEKIVEELGKEYKGNAYH.LMHKNCNH | |
Retrocopy | GGHPYPF<SGIFEISPGNASELGETFKFKEAVVLGSPDFLEDDIEKIVEELGKEYKGNAYH>LMHKNCNH |
Parental | -FSSALSE-ILCGKEI-PRWINRL-AYFSSCIPFLQS-CLPKEWLTPAALQS |
.FSSALSE.ILCGK.I.P.W.NRL.AYFSSCIPFL.S.C..K..LT.AAL.. | |
Retrocopy | >FSSALSE>ILCGKDI>PSWENRL>AYFSSCIPFLPS>CSGKK*LTLAALEA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 1 .45 RPM |
SRP017611_kidney | 0 .00 RPM | 2 .81 RPM |
SRP017611_liver | 0 .00 RPM | 0 .80 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000016 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003484 | 3 retrocopies | |
Erinaceus europaeus | ENSEEUG00000009507 | 2 retrocopies |
retro_eeur_394, retro_eeur_470 ,
|
Homo sapiens | ENSG00000121644 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009797 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004019 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015368 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000000055 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000002180 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000010876 | 1 retrocopy | |
Drosophila melanogaster | FBgn0033551 | 1 retrocopy |