RetrogeneDB ID: | retro_ptro_1384 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 19:62359288..62359609(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DESI2 | ||
Ensembl ID: | ENSPTRG00000002180 | ||
Aliases: | None | ||
Description: | desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:24264] |
Percent Identity: | 91.59 % |
Parental protein coverage: | 58.47 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | FSQYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFL |
...YWM.EYTSSIGIGVFHS.IEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKE.VVLGSTDFL | |
Retrocopy | YDTYWMKEYTSSIGIGVFHSEIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEVVVLGSTDFL |
Parental | EDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEI |
EDDIEKIVEELGKEYKGN.YHLM.KNCNHFSSALSE. | |
Retrocopy | EDDIEKIVEELGKEYKGNVYHLMYKNCNHFSSALSEV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .09 RPM | 0 .52 RPM |
SRP007412_cerebellum | 0 .65 RPM | 2 .62 RPM |
SRP007412_heart | 0 .44 RPM | 2 .59 RPM |
SRP007412_kidney | 0 .16 RPM | 1 .46 RPM |
SRP007412_liver | 0 .20 RPM | 0 .88 RPM |
SRP007412_testis | 8 .01 RPM | 25 .71 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_1493 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000016 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003484 | 3 retrocopies | |
Erinaceus europaeus | ENSEEUG00000009507 | 2 retrocopies | |
Homo sapiens | ENSG00000121644 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009797 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004019 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015368 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000000055 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000002180 | 1 retrocopy |
retro_ptro_1384 ,
|
Sus scrofa | ENSSSCG00000010876 | 1 retrocopy | |
Drosophila melanogaster | FBgn0033551 | 1 retrocopy |