RetrogeneDB ID: | retro_etel_1627 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_284001:275..680(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000001255 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUDT4 | ||
| Ensembl ID: | ENSETEG00000013922 | ||
| Aliases: | None | ||
| Description: | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Source:HGNC Symbol;Acc:8051] |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 91.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTE |
| VLLVSSSRYPD.WIVPGGG.EPEEEPG.AAVREVYEEAGVKG.LGRLLGVFEQ....KHRTYV.VLTVTE | |
| Retrocopy | VLLVSSSRYPDRWIVPGGGLEPEEEPGSAAVREVYEEAGVKGNLGRLLGVFEQSHEPKHRTYVFVLTVTE |
| Parental | ILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTNGNSSAPSLPDSNALFV |
| .LEDWEDSV.IGRKR.WF.VE.AI.VLQCHKPVHAEYLEKL.LG.S..NG.S.A.S.PDS....V | |
| Retrocopy | LLEDWEDSVSIGRKRQWFRVEEAIRVLQCHKPVHAEYLEKLQLGGSQGNGLSTASSPPDSQS*YV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009844 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015207 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000000647 | 3 retrocopies | |
| Equus caballus | ENSECAG00000019319 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013922 | 2 retrocopies |
retro_etel_1627 , retro_etel_2111,
|
| Gorilla gorilla | ENSGGOG00000014324 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013776 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007100 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002767 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009468 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020029 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011283 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013730 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020306 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012198 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003309 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002957 | 1 retrocopy |