RetrogeneDB ID: | retro_fcat_1189 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:62855385..62855630(-) | ||
| Located in intron of: | ENSFCAG00000014089 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000028856 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.82 % |
| Parental protein coverage: | 51.85 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | CLSVNDVFVTTEWGRAHNSGGKVRLLADPTGAFGKETGLLLDDSLVSLFGNRRLKR-FSMVVEDGVVKSL |
| CLSV.....T.EW..AHN..GKV.LLA.PTG..G..T.LL.D.SL..LF....LK..FSM....G.VK.L | |
| Retrocopy | CLSVH--VMTGEWV*AHNMEGKVQLLAGPTGTSGEGTNLLQDASLLPLFEIGWLKG<FSMIMDEGMVKAL |
| Parental | NVEPDGTGLTCSLAS |
| N.EP.GTGLTCSLAS | |
| Retrocopy | NTEPEGTGLTCSLAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 84 .59 RPM |
| SRP017611_kidney | 0 .00 RPM | 184 .37 RPM |
| SRP017611_liver | 0 .00 RPM | 31 .44 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008648 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018014 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004647 | 1 retrocopy | |
| Equus caballus | ENSECAG00000017747 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000000264 | 3 retrocopies | |
| Felis catus | ENSFCAG00000028856 | 3 retrocopies |
retro_fcat_1189 , retro_fcat_410, retro_fcat_727,
|
| Homo sapiens | ENSG00000126432 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001337 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025661 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013397 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005003 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000010811 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003106 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013030 | 2 retrocopies |