RetrogeneDB ID: | retro_mmul_504 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:79190884..79191248(-) | ||
| Located in intron of: | ENSMMUG00000005990 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.4338 | ||
| Ensembl ID: | ENSMMUG00000013397 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 99.19 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | VGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFT-PGC-SKTHLPGFVEQAEALKAK-GVQVLA |
| VG.AI.A..VFE.EPGNKV.L.EL..GKKGVL...PGAFT.P.C.SKTHL.GF.E.A..L..K.G..... | |
| Retrocopy | VGVAILALVVFEREPGNKVDLTELCQGKKGVLLRIPGAFT<PKC<SKTHLLGFGE*AGVLNVK>GARSMS |
| Parental | CLSVNDAFVTGEWGRA-HKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLK |
| .......FVTGEWG.A.H.AEG..RL.....G..GKETDLLLDDSL...FG...L. | |
| Retrocopy | KFHCLCVFVTGEWG*A<HTAEGQDRLMGGSPGTSGKETDLLLDDSLLPLFGDESLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 48 .97 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 79 .17 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 68 .06 RPM |
| SRP007412_heart | 0 .00 RPM | 65 .48 RPM |
| SRP007412_kidney | 0 .00 RPM | 92 .37 RPM |
| SRP007412_liver | 0 .00 RPM | 84 .04 RPM |
| SRP007412_testis | 0 .00 RPM | 56 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017959 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008648 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018014 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004647 | 1 retrocopy | |
| Equus caballus | ENSECAG00000017747 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000000264 | 3 retrocopies | |
| Felis catus | ENSFCAG00000028856 | 3 retrocopies | |
| Homo sapiens | ENSG00000126432 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001337 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025661 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013397 | 1 retrocopy |
retro_mmul_504 ,
|
| Mustela putorius furo | ENSMPUG00000012907 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005003 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000010811 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003106 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013030 | 2 retrocopies |