RetrogeneDB ID: | retro_fcat_1310 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C2:142557479..142557921(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC9 | ||
| Ensembl ID: | ENSFCAG00000004448 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 9 [Source:HGNC Symbol;Acc:19123] |
| Percent Identity: | 51.68 % |
| Parental protein coverage: | 56.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | EDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEIPSYNAFVK |
| ED.Q.F.K...GSEEELADI.QA.L.F...M.Q..ESVL....TE.PRIRN..QQ....GE.P.Y.AF.K | |
| Retrocopy | EDFQEFAKICQGSEEELADIEQARLNFERNMGQPTESVLHTRPTE*PRIRNVVQQTNHTGEGPAYDAFAK |
| Parental | ESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDNLKAVIQSRQ-KDR-QKEMDNFLAQMEAKYCKPSKR |
| ESKQKMNARKR......K.........GLDE..........S.Q.K.R.Q.EMD..L.QME.KY.KPSK. | |
| Retrocopy | ESKQKMNARKR-SGKRLKTQK*PGRGWGLDEDTGGYPGSSCSKQAKGR>QQEMDTVLTQMESKYYKPSKS |
| Parental | GGKKTPLKK |
| ..K....KK | |
| Retrocopy | RSKELSRKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 3 .67 RPM |
| SRP017611_kidney | 0 .00 RPM | 2 .27 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016933 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004448 | 1 retrocopy |
retro_fcat_1310 ,
|
| Homo sapiens | ENSG00000213551 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015046 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004539 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003792 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016595 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003496 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002343 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000034219 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000028067 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000011504 | 1 retrocopy |