RetrogeneDB ID: | retro_ggor_1402 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 18:19932736..19933168(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2C | ||
| Ensembl ID: | ENSGGOG00000026061 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.67 % |
| Parental protein coverage: | 81.77 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | RLQQELMTLMMSGDKGISAFPESDNLFKWVG-TIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPC |
| R.QQEL.TL..SG.KGISA.P.SDNL.K.VG.TI..AAGT..EDLRYK.SLEFPSGYPYN.P.VKFLTPC | |
| Retrocopy | RIQQELKTLVISGNKGISALPASDNLLKSVG<TIPEAAGT--EDLRYKVSLEFPSGYPYNMPLVKFLTPC |
| Parental | YHPNVDTQ-GNICLDILKEKWSALYDVRTILLSIQSLLGATEPNIDSPLNTHAAELWKNPTAFKKYLQET |
| Y..NVD.Q..N.CLDILK.KWSALYDVR..L.SI.SLL...E.NI.S.LNTHAAEL.KN.TAFKKYLQE. | |
| Retrocopy | YYLNVDAQ>VNTCLDILKDKWSALYDVRNTLHSIHSLL--VELNINSLLNTHAAEL*KNSTAFKKYLQEI |
| Parental | YSKQVTSQEP |
| YSK.V...EP | |
| Retrocopy | YSKHVSRKEP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .12 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .09 RPM |
| SRP007412_kidney | 0 .04 RPM | 0 .33 RPM |
| SRP007412_liver | 0 .05 RPM | 0 .55 RPM |
| SRP007412_testis | 0 .10 RPM | 3 .94 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1922 |
| Pongo abelii | retro_pabe_1589 |
| Macaca mulatta | retro_mmul_1345 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014102 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000011774 | 4 retrocopies | |
| Homo sapiens | ENSG00000175063 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026061 | 3 retrocopies |
retro_ggor_1130, retro_ggor_1402 , retro_ggor_2035,
|
| Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006715 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000001403 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
| Ochotona princeps | ENSOPRG00000014284 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000011071 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000369 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015131 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015987 | 1 retrocopy |