RetrogeneDB ID: | retro_ggor_1585 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 21:33760593..33761008(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SSR4 | ||
Ensembl ID: | ENSGGOG00000024329 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.03 % |
Parental protein coverage: | 82.08 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | EPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSA |
.P...PSY...S.A..STETV.IV..SLT.KN...N..L.ADVG........G....R.Q..WS..H..A | |
Retrocopy | QPLMLPSYSMASGAILSTETVSIVTLSLTWKNGTGNIPLGADVGEESSFQSPGARTWRSQLLWSMKHQDA |
Parental | HAGT-YEVRFFDEESYSLLRKA-QRNNEDISIIPPLFTVSVDHRGTW-NGPWVSTEVLAVAIGLVIYYLA |
H.G...E.R.F..ES...LRK..Q.N.EDIS.I.PLFTV.V.HRG.W..GPWVSTEVLA..I......LA | |
Retrocopy | HSGA>AEIRLFEKESCGRLRKS<QKNFEDISAIHPLFTVEVEHRGSW>GGPWVSTEVLAATI----HFLA |
Parental | FSAKS |
F.A.S | |
Retrocopy | FRARS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 21 .87 RPM |
SRP007412_cerebellum | 0 .08 RPM | 22 .69 RPM |
SRP007412_heart | 0 .03 RPM | 11 .82 RPM |
SRP007412_kidney | 0 .04 RPM | 39 .91 RPM |
SRP007412_liver | 0 .11 RPM | 59 .48 RPM |
SRP007412_testis | 0 .10 RPM | 21 .96 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2536 |
Callithrix jacchus | retro_cjac_2056 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000011328 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011167 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000025714 | 2 retrocopies | |
Homo sapiens | ENSG00000180879 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000024329 | 1 retrocopy |
retro_ggor_1585 ,
|
Loxodonta africana | ENSLAFG00000006908 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008803 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013602 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006738 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000009037 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012784 | 1 retrocopy |