RetrogeneDB ID: | retro_ggor_1942 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:58980195..58980534(-) | ||
| Located in intron of: | ENSGGOG00000004557 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RNF7 | ||
| Ensembl ID: | ENSGGOG00000001829 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.73 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ |
| MADVEDGEE..AL.SHS.S.GSKSGGDKMF.LKKWN.VAMWSW.VECD.CAICRVQVMDACLRCQAENKQ | |
| Retrocopy | MADVEDGEEPYALTSHSRSAGSKSGGDKMF*LKKWNVVAMWSWAVECDMCAICRVQVMDACLRCQAENKQ |
| Parental | EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
| ED.VVV.GECNHSF.NC.MSLWVKQNNRCPLCQQDWV..RIGK | |
| Retrocopy | EDSVVVLGECNHSFRNCRMSLWVKQNNRCPLCQQDWVARRIGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 20 .91 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 19 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .57 RPM |
| SRP007412_kidney | 0 .00 RPM | 35 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 21 .58 RPM |
| SRP007412_testis | 0 .10 RPM | 40 .92 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_1440 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007694 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000010742 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001991 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005961 | 3 retrocopies | |
| Homo sapiens | ENSG00000114125 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001829 | 1 retrocopy |
retro_ggor_1942 ,
|
| Microcebus murinus | ENSMICG00000001353 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006648 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000021232 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000051234 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004646 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008659 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014167 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000039248 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011663 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014964 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002917 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000007778 | 5 retrocopies |