RetrogeneDB ID: | retro_ggor_2704 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 8:23512933..23513321(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM60A | ||
Ensembl ID: | ENSGGOG00000015484 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.54 % |
Parental protein coverage: | 58.37 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | WNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDD |
WNHVV..R.GPS.K.TLKP.KVKTLS.NRIKS.QISKLQKEF.RHNSDAH.TTS.A.PAQSPC.SNQ.DD | |
Retrocopy | WNHVVVTRPGPSIKSTLKP*KVKTLSENRIKSIQISKLQKEFERHNSDAHNTTSNAPPAQSPCNSNQLDD |
Parental | GSDTEMASGSNRTPVFSFLDLTYWKR-QKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAA |
.SDTEM.SGSNRTP.............QK..CG.IYKG.FGEVL..THLFK.CCS.KKAA | |
Retrocopy | SSDTEMVSGSNRTPXXXXXXSSHTEK>QKRHCGVIYKGCFGEVLNNTHLFKSCCSHKKAA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .48 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .14 RPM |
SRP007412_heart | 0 .00 RPM | 0 .50 RPM |
SRP007412_kidney | 0 .00 RPM | 5 .72 RPM |
SRP007412_liver | 0 .00 RPM | 1 .00 RPM |
SRP007412_testis | 0 .00 RPM | 14 .40 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4029 |
Pongo abelii | retro_pabe_3309 |
Macaca mulatta | retro_mmul_2324 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001161 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000010685 | 4 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000007193 | 17 retrocopies | |
Callithrix jacchus | ENSCJAG00000001215 | 3 retrocopies | |
Felis catus | ENSFCAG00000008955 | 4 retrocopies | |
Homo sapiens | ENSG00000139146 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000015484 | 3 retrocopies |
retro_ggor_1405, retro_ggor_1415, retro_ggor_2704 ,
|
Myotis lucifugus | ENSMLUG00000009827 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000009155 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016487 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008927 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000004396 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000046048 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000049943 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006261 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000007097 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000008465 | 3 retrocopies |