RetrogeneDB ID: | retro_ggor_271 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:102177807..102178208(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C1ORF123 | ||
| Ensembl ID: | ENSGGOG00000004027 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.85 % |
| Parental protein coverage: | 84.38 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARE-NSIEILSSTIKPYNAEDNENF |
| .WYLKMKCGN..EIS.KW.YI.LMDSVALK.G.GS..MVQKCKLC..E.NS..ILS..IK.YNA.D.E.F | |
| Retrocopy | QWYLKMKCGNGSEISEKWHYIQLMDSVALKWGHGSSFMVQKCKLCTQE<NSTVILSGSIKSYNAKDREKF |
| Parental | KTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC |
| KTI.EFEC.G..P.DFQP.AGF.AEG..S.T.F.DI.LQEKDWTDYD.K..ESVGI.EV..QF.KC | |
| Retrocopy | KTIIEFECQGFKPFDFQP*AGFSAEGTKSKTVFGDI-LQEKDWTDYDKKSRESVGISEVMQQFLKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .69 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 34 .63 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .79 RPM |
| SRP007412_kidney | 0 .00 RPM | 32 .96 RPM |
| SRP007412_liver | 0 .00 RPM | 27 .80 RPM |
| SRP007412_testis | 0 .00 RPM | 47 .97 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_192 |
| Pongo abelii | retro_pabe_443 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
| Homo sapiens | ENSG00000162384 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy |
retro_ggor_271 ,
|
| Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |