RetrogeneDB ID: | retro_ggor_2756 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 8:102822176..102822476(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MED21 | ||
Ensembl ID: | ENSGGOG00000016313 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82. % |
Parental protein coverage: | 69.44 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | DRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDIDVL |
D.L.QL.D..NSL.DQFCNA..VLQQCG.PASFNNIQTAINKDQPANPTEEYAQL..ALIA.TAKDI.VL | |
Retrocopy | DQLMQL*DTMNSLSDQFCNATDVLQQCGLPASFNNIQTAINKDQPANPTEEYAQLLIALIAQTAKDIHVL |
Parental | IDSLPSEESTAALQAASLYKLEEENHEAAT |
IDSLPSEESTAAL.A..L.KLEE.NHEAAT | |
Retrocopy | IDSLPSEESTAAL*ATPLCKLEEQNHEAAT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 10 .84 RPM |
SRP007412_cerebellum | 0 .04 RPM | 10 .40 RPM |
SRP007412_heart | 0 .00 RPM | 3 .66 RPM |
SRP007412_kidney | 0 .04 RPM | 18 .15 RPM |
SRP007412_liver | 0 .00 RPM | 7 .89 RPM |
SRP007412_testis | 0 .00 RPM | 45 .48 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4105 |
Pan troglodytes | retro_ptro_2786 |
Pongo abelii | retro_pabe_3361 |
Macaca mulatta | retro_mmul_2365 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011670 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010041 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006223 | 1 retrocopy | |
Felis catus | ENSFCAG00000030691 | 1 retrocopy | |
Homo sapiens | ENSG00000152944 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016313 | 1 retrocopy |
retro_ggor_2756 ,
|
Myotis lucifugus | ENSMLUG00000007678 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003218 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005431 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004377 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004785 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013357 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008391 | 2 retrocopies |