RetrogeneDB ID: | retro_pabe_3361 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 8:110213045..110213348(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MED21 | ||
Ensembl ID: | ENSPPYG00000004377 | ||
Aliases: | None | ||
Description: | mediator of RNA polymerase II transcription subunit 21 [Source:RefSeq peptide;Acc:NP_001124922] |
Percent Identity: | 67.33 % |
Parental protein coverage: | 70.14 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | ADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANSTEEYAQLFAALIARTAKDIDA |
.D.L.QL....N.LADQFCNA..VLQQCG.PASF.NIQTAINKDQPAN.TEEYAQL..ALIA.TAKDI.. | |
Retrocopy | SDQLMQL*NTMNLLADQFCNATDVLQQCGLPASFNNIQTAINKDQPANPTEEYAQLLIALIAQTAKDIHV |
Parental | RNCIPLEEESFSALFAASLYKLEEENHEAAT |
.......EES..A..A..L.KLEE.NHEAAT | |
Retrocopy | LIDSLPSEESTAAS*ATPLCKLEEQNHEAAT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .22 RPM | 4 .48 RPM |
SRP007412_cerebellum | 0 .24 RPM | 6 .69 RPM |
SRP007412_heart | 0 .36 RPM | 7 .04 RPM |
SRP007412_kidney | 0 .33 RPM | 5 .57 RPM |
SRP007412_liver | 0 .28 RPM | 4 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4105 |
Pan troglodytes | retro_ptro_2786 |
Gorilla gorilla | retro_ggor_2756 |
Macaca mulatta | retro_mmul_2365 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011670 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010041 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006223 | 1 retrocopy | |
Felis catus | ENSFCAG00000030691 | 1 retrocopy | |
Homo sapiens | ENSG00000152944 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016313 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007678 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003218 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005431 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004377 | 1 retrocopy |
retro_pabe_3361 ,
|
Pan troglodytes | ENSPTRG00000004785 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013357 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008391 | 2 retrocopies |