RetrogeneDB ID: | retro_ggor_2812 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 9:77943906..77944185(+) | ||
Located in intron of: | ENSGGOG00000002705 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PARK7 | ||
Ensembl ID: | ENSGGOG00000012105 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 54.84 % |
Parental protein coverage: | 60. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAAPFIILSLARGCVVTLLPKPISKNKKI |
G..D...L.GGNLGAQ.L.ESAA..EILKEQEN.KGLIA.I.A.P...L....G...........K.K.. | |
Retrocopy | GLNDTMFLTGGNLGAQILFESAALREILKEQENEKGLIATIYAGPAGLLAHEIGFGSKVTTYLLAKDKMM |
Parental | SAGHYTYSENRVEKDGLILTSRG |
...HY.YSEN.VEKD.LI.TSRG | |
Retrocopy | NGSHYSYSENCVEKDSLIFTSRG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 133 .50 RPM |
SRP007412_cerebellum | 0 .00 RPM | 101 .25 RPM |
SRP007412_heart | 0 .03 RPM | 53 .69 RPM |
SRP007412_kidney | 0 .00 RPM | 134 .40 RPM |
SRP007412_liver | 0 .00 RPM | 75 .78 RPM |
SRP007412_testis | 0 .10 RPM | 98 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003703 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000019674 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004364 | 7 retrocopies | |
Callithrix jacchus | ENSCJAG00000000319 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000013141 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010915 | 1 retrocopy | |
Homo sapiens | ENSG00000116288 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000012105 | 2 retrocopies |
retro_ggor_2812 , retro_ggor_795,
|
Microcebus murinus | ENSMICG00000008470 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008790 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016511 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002151 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001925 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000000102 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000018289 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000009474 | 13 retrocopies | |
Tarsius syrichta | ENSTSYG00000001455 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000011076 | 1 retrocopy |