RetrogeneDB ID: | retro_ggor_2843 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 9:33329709..33329970(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS11 | ||
Ensembl ID: | ENSGGOG00000002936 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.82 % |
Parental protein coverage: | 55.06 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | YKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRH |
YKNI.LGF.TPKEAIEGTY.DKKCPFTGNVSI...ILSG...KMKM.RT.VI..DYL.Y..K.....K.H | |
Retrocopy | YKNISLGFRTPKEAIEGTYMDKKCPFTGNVSI*RQILSGEGSKMKMERTTVIH*DYLCYMYKHSCSKKCH |
Parental | KNMSVHLSPCFRDVQIG |
KN.SV.LS.CFR.V..G | |
Retrocopy | KNVSVSLSSCFREV*VG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 282 .02 RPM |
SRP007412_cerebellum | 0 .00 RPM | 344 .10 RPM |
SRP007412_heart | 0 .03 RPM | 194 .47 RPM |
SRP007412_kidney | 0 .00 RPM | 503 .06 RPM |
SRP007412_liver | 0 .00 RPM | 436 .42 RPM |
SRP007412_testis | 0 .10 RPM | 389 .95 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014020 | 13 retrocopies | |
Bos taurus | ENSBTAG00000013924 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000003631 | 9 retrocopies | |
Callithrix jacchus | ENSCJAG00000000069 | 1 retrocopy | |
Danio rerio | ENSDARG00000053058 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000016107 | 9 retrocopies | |
Equus caballus | ENSECAG00000000370 | 1 retrocopy | |
Felis catus | ENSFCAG00000009196 | 13 retrocopies | |
Gorilla gorilla | ENSGGOG00000002936 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000030475 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007549 | 6 retrocopies | |
Monodelphis domestica | ENSMODG00000013434 | 7 retrocopies | |
Otolemur garnettii | ENSOGAG00000004627 | 7 retrocopies | |
Pan troglodytes | ENSPTRG00000011299 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000020595 | 18 retrocopies | |
Sorex araneus | ENSSARG00000003236 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000003165 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000023443 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000016677 | 16 retrocopies |