RetrogeneDB ID: | retro_ggor_2884 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:113464866..113465075(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSGGOG00000007650 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.06 % |
| Parental protein coverage: | 55.47 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTK-KHV |
| T.R.RLS.NTASN.TR..RTPG.RIVYL.T.K.GK.PKSA.GV..G.LR.V.AVRPK..MRL..TK.KHV | |
| Retrocopy | TNRHRLSQNTASNSTRPARTPGKRIVYLCT-KTGKLPKSAHGVGLG*LREVCAVRPKAPMRLPQTK<KHV |
| Parental | SR |
| S. | |
| Retrocopy | SK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 67 .14 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 96 .60 RPM |
| SRP007412_heart | 0 .00 RPM | 42 .96 RPM |
| SRP007412_kidney | 0 .00 RPM | 227 .51 RPM |
| SRP007412_liver | 0 .00 RPM | 244 .87 RPM |
| SRP007412_testis | 0 .00 RPM | 93 .24 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4314 |
| Pan troglodytes | retro_ptro_2922 |