RetrogeneDB ID: | retro_itri_835 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393331.1:1824648..1824866(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CENPA | ||
| Ensembl ID: | ENSSTOG00000025168 | ||
| Aliases: | None | ||
| Description: | centromere protein A [Source:HGNC Symbol;Acc:1851] |
| Percent Identity: | 57.33 % |
| Parental protein coverage: | 53.62 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | LQKSTDLLIRRYPFSRLAREICMKFTRGVDFSWQAQALLALQEAAEAFLV-HLFEDAYLLSLHAGRVTLF |
| L.KSTDLL..RYP...LAR.I...FT.GVD.S.QAQA.........AF.V..LF..A.LLSL..G..TLF | |
| Retrocopy | LPKSTDLLASRYPLGHLARRIPIQFTHGVDISGQAQAH*GPLSGSRAFPV<LLF*GA*LLSLQ-G*ATLF |
| Parental | PKDVQ |
| PKDVQ | |
| Retrocopy | PKDVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000023938 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004496 | 3 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000000516 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024154 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000025168 | 2 retrocopies |
retro_itri_835 , retro_itri_994,
|
| Tarsius syrichta | ENSTSYG00000010334 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010278 | 2 retrocopies |