RetrogeneDB ID: | retro_lafr_363 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_13:58250073..58250271(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFDN6 | ||
Ensembl ID: | ENSLAFG00000012967 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 90.91 % |
Parental protein coverage: | 51.16 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQEL |
LI.KKLQG.VEKYQQLQKDLSKSMSGRQKLEAQLTENN.VK.ELALLDGSN..FKLLGPVLVKQEL | |
Retrocopy | LI*KKLQGQVEKYQQLQKDLSKSMSGRQKLEAQLTENNVVKGELALLDGSNLAFKLLGPVLVKQEL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000011211 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000012967 | 1 retrocopy |
retro_lafr_363 ,
|
Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000006019 | 1 retrocopy |