RetrogeneDB ID: | retro_lafr_825 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_4:97686551..97686701(+) | ||
Located in intron of: | ENSLAFG00000007870 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MINOS1 | ||
Ensembl ID: | ENSLAFG00000016199 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 80.39 % |
Parental protein coverage: | 68.92 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSESELGRKWDRCLADAVVKIGTGFGLGVVFSLTFFKRRMWPLAFGSGMGL |
MS.S.L.RKWDRCL.DAVVKIGTGFGLG.VFSL..FK..MWPLAFGSGM.L | |
Retrocopy | MSDSDLSRKWDRCLVDAVVKIGTGFGLGIVFSLALFK-GMWPLAFGSGMAL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies | |
Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy |
retro_lafr_825 ,
|
Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000028414 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |