RetrogeneDB ID: | retro_rnor_16 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:104996610..104996841(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSRNOG00000029172 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Minos1 | ||
| Ensembl ID: | ENSRNOG00000042696 | ||
| Aliases: | Minos1, RGD1560187 | ||
| Description: | Mitochondrial inner membrane organizing system protein 1 [Source:UniProtKB/Swiss-Prot;Acc:B2RYW8] |
| Percent Identity: | 93.42 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSESEPGRKWDRCMADALVKLGTGFGLGMVFSLTFFKRRKWPLAFGSGVGLGMAYSNCQHDFQAPYLLHG |
| MSESEPGRKW.RCMADA.VKLGTGFGLG.VFSLTFFKRR.WPLAF.SGVGLGMAYSNCQHDFQAPYLLHG | |
| Retrocopy | MSESEPGRKWVRCMADAVVKLGTGFGLGIVFSLTFFKRRMWPLAFASGVGLGMAYSNCQHDFQAPYLLHG |
| Parental | KYVKEQ |
| KYVKEQ | |
| Retrocopy | KYVKEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .36 RPM | 24 .30 RPM |
| SRP017611_kidney | 0 .35 RPM | 57 .43 RPM |
| SRP017611_liver | 0 .13 RPM | 20 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
| Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
| Homo sapiens | ENSG00000173436 | 3 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies |
retro_rnor_16 , retro_rnor_2460,
|
| Sus scrofa | ENSSSCG00000028414 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |