RetrogeneDB ID: | retro_tbel_4339 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_77575:6886..7105(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MINOS1 | ||
Ensembl ID: | ENSTBEG00000004024 | ||
Aliases: | None | ||
Description: | mitochondrial inner membrane organizing system 1 [Source:HGNC Symbol;Acc:32068] |
Percent Identity: | 86.3 % |
Parental protein coverage: | 98.65 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSESELGQKWDRCMADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG |
M.ESELGQKWD..MADAVV.I.TGFGLGIVF.LTFFKRRMWPLAFGSGMG.GM.YSNCQ.DFQAPYLLH. | |
Retrocopy | M*ESELGQKWDSGMADAVVQINTGFGLGIVFALTFFKRRMWPLAFGSGMGPGMVYSNCQYDFQAPYLLHW |
Parental | KYV |
KYV | |
Retrocopy | KYV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies | |
Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy | |
Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000028414 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy |
retro_tbel_4339 ,
|
Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |