RetrogeneDB ID: | retro_mdom_1079 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:15683020..15683347(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5D | ||
| Ensembl ID: | ENSMODG00000005314 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit [Source:HGNC Symbol;Acc:837] |
| Percent Identity: | 51.3 % |
| Parental protein coverage: | 66.47 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | NVKQVDVPTQSGAFGILAAHVPTLQVLKPGIVTVHAEDGTTTKYFVSSGSITVNADSSVQLLAEEAVSLD |
| .......P..SG...I..A.....QVL.........EDG.T..YFVS.GS..VN..SSVQL.AEE.VSLD | |
| Retrocopy | SMRPMKSPNHSGTV*IWTAQILVVQVLRK---MCRCEDGLTIRYFVSNGSNSVN--SSVQLPAEETVSLD |
| Parental | MLDLGAAKSNLEKAHSELSGASDEAARAEAQIRIEANEAIVKALE |
| .L...AAKSNLEK.HS.LS.AS.EA...E.Q..IE..EA.VKA.E | |
| Retrocopy | KLAI-AAKSNLEKIHSDLSRASEEAPLTEVQT*IEVIEAAVKA*E |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000002168 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019536 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000014960 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015004 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000005314 | 1 retrocopy |
retro_mdom_1079 ,
|
| Rattus norvegicus | ENSRNOG00000014625 | 1 retrocopy |