RetrogeneDB ID: | retro_mdom_1113 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 3:144041471..144041711(-) | ||
Located in intron of: | ENSMODG00000005451 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF1B | ||
Ensembl ID: | ENSMODG00000011056 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 1B [Source:HGNC Symbol;Acc:30792] |
Percent Identity: | 82.5 % |
Parental protein coverage: | 70.8 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIV |
RIQ....RKTL.TVQGIAD.Y.KKKLVKAFKKKFACNGTVI.HPEY..VIQL.GDQR.NI.QFLLEVGIV | |
Retrocopy | RIQPWKDRKTLHTVQGIADNYEKKKLVKAFKKKFACNGTVIKHPEYSKVIQL*GDQRRNISQFLLEVGIV |
Parental | KEEQLKVHGF |
KE.QLKVHGF | |
Retrocopy | KEKQLKVHGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000013689 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000017295 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000013223 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000017704 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000011056 | 2 retrocopies |
retro_mdom_1113 , retro_mdom_1382,
|
Mus musculus | ENSMUSG00000006941 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000025224 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000012168 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013185 | 6 retrocopies | |
Tarsius syrichta | ENSTSYG00000006338 | 3 retrocopies |