RetrogeneDB ID: | retro_tbel_3867 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_2503:4367..4601(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF1B | ||
Ensembl ID: | ENSTBEG00000013185 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 1B [Source:HGNC Symbol;Acc:30792] |
Percent Identity: | 75.64 % |
Parental protein coverage: | 69.03 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | IQQRNGRKTLTTVQGIADDYDKKKVVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVK |
IQQRN.RKTLTTVQGIA.DY.KKK.VKA.KK.FAC.GTV..HPEYGEV.QLQGDQRK..CQFL.E.G..K | |
Retrocopy | IQQRNDRKTLTTVQGIAVDYNKKKLVKAVKKTFACHGTVNDHPEYGEVTQLQGDQRKDTCQFLVETGLAK |
Parental | QEQLKVHG |
..QLKV.G | |
Retrocopy | GGQLKVYG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000013689 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000017295 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000013223 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000017704 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000011056 | 2 retrocopies | |
Mus musculus | ENSMUSG00000006941 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000025224 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000012168 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013185 | 6 retrocopies |
retro_tbel_1861, retro_tbel_1920, retro_tbel_1996, retro_tbel_2954, retro_tbel_3209, retro_tbel_3867 ,
|
Tarsius syrichta | ENSTSYG00000006338 | 3 retrocopies |