RetrogeneDB ID: | retro_tsyr_2154 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_97249:7020..7224(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTSYG00000006338 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 67.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | TTVQG-IADDYDK-KKLVKAFKKKFACNGTVIEHPEYGEVIQLQ-GDQRKNICQFLLEVGIVKEEQLKVH |
| TTVQG.I.DDYDK.KKLV..FKKKFACNGT.IEH.EY.EVI.LQ.G.QRKNICQFLLE...VK..Q.K.H | |
| Retrocopy | TTVQG<IIDDYDK<KKLVTVFKKKFACNGTIIEHLEYAEVIRLQ<GNQRKNICQFLLETELVKDDQVKFH |
| Parental | GF |
| GF | |
| Retrocopy | GF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000013689 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000017295 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000013223 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000017704 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011056 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000006941 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025224 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012168 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013185 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006338 | 3 retrocopies |
retro_tsyr_1574, retro_tsyr_2154 , retro_tsyr_888,
|