RetrogeneDB ID: | retro_mdom_347 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:240529525..240529855(+) | ||
Located in intron of: | ENSMODG00000004554 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SKA2 | ||
Ensembl ID: | ENSMODG00000014619 | ||
Aliases: | None | ||
Description: | spindle and kinetochore associated complex subunit 2 [Source:HGNC Symbol;Acc:28006] |
Percent Identity: | 89.19 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | FQKAESDLDYIQHKLEFEVEKNLPDNSSGE-NPLTLLKEFSMMKSRYKTLCAQLEQVAVEQKESMNCIRA |
FQKAESDLDYIQHKLEFEVEKNLPDN.SGE.NPL..LKEFSMMKS.YKTLCAQLEQVAVEQKESMNCI.A | |
Retrocopy | FQKAESDLDYIQHKLEFEVEKNLPDNLSGEENPLIVLKEFSMMKS*YKTLCAQLEQVAVEQKESMNCICA |
Parental | TLNNTMKMVQQLEQQADLELSPLTKEEQTAVQQLQSHSTCQ |
TLNNT.K.V.QLEQQ.DLELSPLTKEEQTAV.Q.QSHSTCQ | |
Retrocopy | TLNNTVKIV-QLEQQTDLELSPLTKEEQTAV*QFQSHSTCQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .48 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .20 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000021680 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000029233 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000006051 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000010768 | 2 retrocopies | |
Equus caballus | ENSECAG00000015007 | 1 retrocopy | |
Felis catus | ENSFCAG00000022802 | 1 retrocopy | |
Homo sapiens | ENSG00000182628 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003405 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010942 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014619 | 1 retrocopy |
retro_mdom_347 ,
|
Mustela putorius furo | ENSMPUG00000015241 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020492 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026072 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000025981 | 3 retrocopies | |
Sorex araneus | ENSSARG00000011128 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000024169 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000006158 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000017196 | 1 retrocopy |