RetrogeneDB ID: | retro_mmus_778 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:30822314..30822670(-) | ||
| Located in intron of: | ENSMUSG00000040850 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000086986 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ska2 | ||
| Ensembl ID: | ENSMUSG00000020492 | ||
| Aliases: | None | ||
| Description: | spindle and kinetochore associated complex subunit 2 [Source:MGI Symbol;Acc:MGI:1913390] |
| Percent Identity: | 80.17 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MEAEVDKLELMFQKADSDLDYLQYRLEYEVKTNHPHSAGEKNAVTVLKELSAIKSRYQALCARFKAVSVE |
| M.AEV.KLELM.QKADSDLDYLQYRLEYE.KTNHPHSAG.KNAV..LKELSAI.S.YQAL.A........ | |
| Retrocopy | MVAEVNKLELMVQKADSDLDYLQYRLEYEIKTNHPHSAGQKNAVAILKELSAIRSQYQALYAALRQFLLS |
| Parental | QKETKSCICATLNKTMTMIQELQKQTNLELTLLTEEEKAATEPL-KSHMPD |
| .KETKSCIC..LNKTMTMIQELQKQTNLELTLLTEEEKA.TE.L.KSHMPD | |
| Retrocopy | -KETKSCICGILNKTMTMIQELQKQTNLELTLLTEEEKAVTEQL<KSHMPD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .14 RPM | 8 .53 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 8 .90 RPM |
| SRP007412_heart | 0 .03 RPM | 9 .68 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .53 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .09 RPM |
| SRP007412_testis | 0 .14 RPM | 5 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021680 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000029233 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006051 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000010768 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015007 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022802 | 1 retrocopy | |
| Homo sapiens | ENSG00000182628 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003405 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010942 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014619 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015241 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020492 | 2 retrocopies |
retro_mmus_370, retro_mmus_778 ,
|
| Otolemur garnettii | ENSOGAG00000026072 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000025981 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000011128 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024169 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006158 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017196 | 1 retrocopy |