RetrogeneDB ID: | retro_mdom_395 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:382188820..382189244(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS23 | ||
Ensembl ID: | ENSMODG00000020255 | ||
Aliases: | None | ||
Description: | ribosomal protein S23 [Source:HGNC Symbol;Acc:10410] |
Percent Identity: | 69.86 % |
Parental protein coverage: | 99.3 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MGKCRGLRTARKL--RSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRK |
.GKC.GL.T..K....S.RRDQ.WHDK.YKKA....ALKA.PF.G.S.AKGIVL.KVGVEA.QPNSAI.K | |
Retrocopy | IGKCHGLCTQ*KALHHSYRRDQNWHDK*YKKA----ALKAIPFRGKSNAKGIVLGKVGVEAMQPNSAIQK |
Parental | CVRVQLIKNGKKI-TAFVPNDGCLNFIEENDEVLVAGFGR-KGHAVGDIPGVRFKVVKVANVSLLALYKG |
.VR.QLIK..KKI.T.FVP.....NF.EEND.VLVAGFG..K.HAVGDIP.V.FKVVKV.N.SLLA.YKG | |
Retrocopy | YVRIQLIKDDKKI>TVFVPKALNFNFVEENDVVLVAGFGQEKSHAVGDIPRVCFKVVKVENISLLASYKG |
Parental | KKERPR |
KKERPR | |
Retrocopy | KKERPR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .12 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000013358 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000011247 | 2 retrocopies | |
Homo sapiens | ENSG00000186468 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000025014 | 6 retrocopies | |
Macaca mulatta | ENSMMUG00000003578 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000020255 | 3 retrocopies |
retro_mdom_1518, retro_mdom_1612, retro_mdom_395 ,
|
Mustela putorius furo | ENSMPUG00000008114 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013203 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010363 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000016580 | 12 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000008347 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000014133 | 1 retrocopy |