RetrogeneDB ID: | retro_mdom_525 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:153377524..153377769(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA5 | ||
Ensembl ID: | ENSMODG00000015384 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 [Source:HGNC Symbol;Acc:7688] |
Percent Identity: | 63.86 % |
Parental protein coverage: | 70.69 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LQLMPANAAYRKYTEQITNERMNMVKEETDLQKLEDQLQSGQLEE-VILQAENELSLARKMLIWKPWEPL |
L.......AYRKYTEQITNER.N..K..T.LQK..DQ.Q.G..EE..ILQ.ENELSLARKML.WKP.EPL | |
Retrocopy | LSRLCSQIAYRKYTEQITNERLNTAKQGTGLQKSKDQIQDGKIEE<MILQTENELSLARKMLTWKPLEPL |
Parental | LEEPPANQWKWPL |
.E...A..WKWPL | |
Retrocopy | EEVLVAKLWKWPL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004512 | 2 retrocopies | |
Bos taurus | ENSBTAG00000009334 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000025112 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000017449 | 1 retrocopy | |
Felis catus | ENSFCAG00000027125 | 5 retrocopies | |
Homo sapiens | ENSG00000128609 | 10 retrocopies | |
Gorilla gorilla | ENSGGOG00000022922 | 9 retrocopies | |
Loxodonta africana | ENSLAFG00000030971 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000015384 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000006811 | 4 retrocopies | |
Mus musculus | ENSMUSG00000023089 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000033137 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000017956 | 10 retrocopies | |
Pan troglodytes | ENSPTRG00000019637 | 10 retrocopies | |
Rattus norvegicus | ENSRNOG00000005698 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000016607 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000027404 | 1 retrocopy |