RetrogeneDB ID: | retro_pabe_2216 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:55762736..55762936(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA5 | ||
| Ensembl ID: | ENSPPYG00000017956 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001125332] |
| Percent Identity: | 66.18 % |
| Parental protein coverage: | 57.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QITNEKLAMVKAEPDVKKLEDQLQGGQLEE-VILQAEHELNLARKMKEWKLWEPLVEEPPADQWKWPI |
| .ITNEK.AM...E.DV.KLEDQL.GGQ..E..IL....EL.LAR.M..WK.W.PLVEEPPA.QWKWPI | |
| Retrocopy | EITNEKPAMIIVESDVQKLEDQLEGGQIGE<EILLGKNELSLARQMMQWKTWKPLVEEPPAHQWKWPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 36 .16 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 33 .56 RPM |
| SRP007412_heart | 0 .00 RPM | 40 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .13 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_1800 |