RetrogeneDB ID: | retro_pabe_2216 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:55762736..55762936(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA5 | ||
Ensembl ID: | ENSPPYG00000017956 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001125332] |
Percent Identity: | 66.18 % |
Parental protein coverage: | 57.76 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | QITNEKLAMVKAEPDVKKLEDQLQGGQLEE-VILQAEHELNLARKMKEWKLWEPLVEEPPADQWKWPI |
.ITNEK.AM...E.DV.KLEDQL.GGQ..E..IL....EL.LAR.M..WK.W.PLVEEPPA.QWKWPI | |
Retrocopy | EITNEKPAMIIVESDVQKLEDQLEGGQIGE<EILLGKNELSLARQMMQWKTWKPLVEEPPAHQWKWPI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 36 .16 RPM |
SRP007412_cerebellum | 0 .00 RPM | 33 .56 RPM |
SRP007412_heart | 0 .00 RPM | 40 .43 RPM |
SRP007412_kidney | 0 .00 RPM | 30 .40 RPM |
SRP007412_liver | 0 .00 RPM | 10 .13 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1800 |