RetrogeneDB ID: | retro_mdom_532 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:187177661..187177907(-) | ||
Located in intron of: | ENSMODG00000001647 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CRIPT | ||
Ensembl ID: | ENSMODG00000000973 | ||
Aliases: | None | ||
Description: | cysteine-rich PDZ-binding protein [Source:HGNC Symbol;Acc:14312] |
Percent Identity: | 74.39 % |
Parental protein coverage: | 81.19 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | KDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICSMCGKK |
K...RNT.ES..RKLNENK.L...K..F..YGKNKFSTCRICKSSVHQPGSHYCQGCAYKKG.CSMCG.K | |
Retrocopy | KNRTRNTIESDRRKLNENKSLS*RKPKFGSYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGTCSMCGEK |
Parental | VLDTKNYKQTSV |
.L.TKN.K..SV | |
Retrocopy | ILNTKNDK*ISV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .12 RPM | 37 .07 RPM |
SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .20 RPM | 46 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015723 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000002633 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000556 | 7 retrocopies | |
Cavia porcellus | ENSCPOG00000008081 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000006085 | 1 retrocopy | |
Equus caballus | ENSECAG00000012342 | 2 retrocopies | |
Felis catus | ENSFCAG00000015610 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000009133 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004193 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005388 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000973 | 1 retrocopy |
retro_mdom_532 ,
|
Otolemur garnettii | ENSOGAG00000008089 | 6 retrocopies | |
Rattus norvegicus | ENSRNOG00000015215 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002853 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000000315 | 1 retrocopy |