RetrogeneDB ID: | retro_cpor_1128 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_49:12925380..12925587(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CRIPT | ||
Ensembl ID: | ENSCPOG00000008081 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55.71 % |
Parental protein coverage: | 69.31 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCA |
.KLGT.ITP..W.DG.RNT......K..ENKAL...K..F....KNK.STC.ICK.SVH.....YCQGCA | |
Retrocopy | EKLGT-ITPGMWTDGVRNTPVTCQEKTKENKALDLEKGKFNLCEKNKLSTCKICKTSVH*LNPPYCQGCA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 6 .27 RPM |
SRP017611_kidney | 0 .00 RPM | 8 .06 RPM |
SRP017611_liver | 0 .00 RPM | 7 .36 RPM |
SRP040447_lung | 0 .03 RPM | 5 .17 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 3 .08 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015723 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000002633 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000556 | 7 retrocopies | |
Cavia porcellus | ENSCPOG00000008081 | 1 retrocopy |
retro_cpor_1128 ,
|
Dipodomys ordii | ENSDORG00000006085 | 1 retrocopy | |
Equus caballus | ENSECAG00000012342 | 2 retrocopies | |
Felis catus | ENSFCAG00000015610 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000009133 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004193 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005388 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000973 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008089 | 6 retrocopies | |
Rattus norvegicus | ENSRNOG00000015215 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002853 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000000315 | 1 retrocopy |