RetrogeneDB ID: | retro_mdom_848 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:190738440..190738833(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000001863 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.37 % |
Parental protein coverage: | 72.13 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | KHFSMFFREQS-KKKMKHAEKILQYLTKRGGHPVLENILKSEVQYWSDGLQALEEALVIEKAVNEELLIL |
.HFS.FFRE.S..K.....E.ILQYL.K.GGH.VLE.ILKSEV..WSDGLQAL.EAL..EKAVNEELL.L | |
Retrocopy | EHFSKFFRE*S<QK*EVTMETILQYLIKGGGHLVLETILKSEVEAWSDGLQALDEALTVEKAVNEELLAL |
Parental | -CNKAKEHEDPHLCGFLESELLDEQVKIIKLLGDYITNLKRLGMPENR-SGEYIFDKYTLGKTCQ |
...KAK.H..PHLCGF..SELLD.QVK.IKL.GDYITNLKRLG..EN..SGEYIF.K.TLG..CQ | |
Retrocopy | <VHKAKDHKYPHLCGFFDSELLDKQVKVIKLFGDYITNLKRLGLSENS<SGEYIFGKHTLGENCQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000004685 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001863 | 5 retrocopies | |
Monodelphis domestica | ENSMODG00000007582 | 9 retrocopies | |
Monodelphis domestica | ENSMODG00000013730 | 3 retrocopies |