RetrogeneDB ID: | retro_mdom_878 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:268620273..268620696(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MEA1 | ||
Ensembl ID: | ENSMODG00000019002 | ||
Aliases: | None | ||
Description: | male-enhanced antigen 1 [Source:HGNC Symbol;Acc:6986] |
Percent Identity: | 56.55 % |
Parental protein coverage: | 82.18 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | EGTGDWSSEEPEEEPEDLGPGP-TDYSYQPLNQDPEQEEVELAPVEAIEDAVTDIQERIQALGLHLPDPP |
.GT.D.S.EE...E.EDLG..P.TDYSYQ.LN..P.QE.VE.A..E.IED...DI.E.I..L.LHLPD.P | |
Retrocopy | QGTDDQSNEELKKETEDLGVSP>TDYSYQSLN*GPKQE-VEPAQGENIEDTLPDIEEHIYIL*LHLPDAP |
Parental | VE-SEDEEEEGAVALSSRSSIPMDPEHVELVKRTMAGISLPAPGVPAWAQEISDAQWEDVVQKTLQARQA |
VE....EEE.....LS.RSSI..D.E.V..VK.TM...SLPAPGVPA..QEISDAQWE....K.L..... | |
Retrocopy | VE<EDEEEEI-TLTLSHRSSISLDQEYVQQVKTTMVKVSLPAPGVPAYIQEISDAQWEGMLKKML*SQKE |
Parental | TSTWK |
.S.WK | |
Retrocopy | ISMWK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012655 | 1 retrocopy | |
Bos taurus | ENSBTAG00000005536 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000001756 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004894 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000022111 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000002439 | 1 retrocopy | |
Felis catus | ENSFCAG00000031337 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013881 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000012138 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000019002 | 1 retrocopy |
retro_mdom_878 ,
|
Oryctolagus cuniculus | ENSOCUG00000001565 | 2 retrocopies | |
Pelodiscus sinensis | ENSPSIG00000002330 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000008711 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017144 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000012294 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006996 | 1 retrocopy |