RetrogeneDB ID: | retro_mmul_1368 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 19:20263490..20263756(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2072 | ||
| Ensembl ID: | ENSMMUG00000011089 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase assembly protein COX16 homolog, mitochondrial [Source:RefSeq peptide;Acc:NP_001181826] |
| Percent Identity: | 69.89 % |
| Parental protein coverage: | 84.91 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | LRYGVPMLLLIVGGSFGLREF-SQIRYDAVKIKMDPEL-EKKLKENKISLESEYEKIKDCKFDDWKNIRG |
| L.Y.VPM.LLIVGGSFGL.EF.SQI.YDAVKIK.DPEL....LK.NK.SLE.EYEKIKD..FD..KNI.G | |
| Retrocopy | LCYRVPM-LLIVGGSFGLCEF<SQI*YDAVKIKTDPEL>XXXLKANKVSLELEYEKIKDSIFDGFKNIQG |
| Parental | PRPWEDPDVLQ-GRNPESLKTKT |
| .R.W.DPD..Q..R.PE.LKTKT | |
| Retrocopy | LRSWKDPDLFQ<KRKPEILKTKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .06 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .98 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 19 .61 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .30 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .04 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000133983 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011089 | 2 retrocopies |
retro_mmul_1368 , retro_mmul_1391,
|
| Nomascus leucogenys | ENSNLEG00000001776 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028663 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005951 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000006494 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047115 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013313 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014791 | 1 retrocopy |