RetrogeneDB ID: | retro_pabe_1664 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 19:20808289..20808529(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX16 | ||
| Ensembl ID: | ENSPPYG00000005951 | ||
| Aliases: | None | ||
| Description: | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:20213] |
| Percent Identity: | 71.6 % |
| Parental protein coverage: | 95.29 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | IIGGSFGLREFSQIRYDAVKTKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQG |
| ..G.SFGL.EF.QI..D.VK.K.DPELEK..K....SLESEYEKI.DS.FDDWKNI.GP.PW.DPDLLQ. | |
| Retrocopy | LLGVSFGLHEFLQI*HDTVKIKIDPELEKN*KQI-VSLESEYEKIRDSTFDDWKNIQGPKPWKDPDLLQE |
| Parental | RNPESLKTKTT |
| RNPE.LKTKTT | |
| Retrocopy | RNPEILKTKTT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .92 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .57 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .93 RPM |
| SRP007412_kidney | 0 .00 RPM | 13 .13 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000133983 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011089 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001776 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028663 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005951 | 2 retrocopies |
retro_pabe_1663, retro_pabe_1664 ,
|
| Pan troglodytes | ENSPTRG00000006494 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047115 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013313 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014791 | 1 retrocopy |