RetrogeneDB ID: | retro_ogar_3045 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873702.1:2000809..2001050(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX16 | ||
| Ensembl ID: | ENSOGAG00000028663 | ||
| Aliases: | None | ||
| Description: | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:20213] |
| Percent Identity: | 55.56 % |
| Parental protein coverage: | 74.53 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | GGSFGLREFSQIRYDAVKIK-IDPELEK-RLKANKISLESEYEKIKDSTFDDWKNIRGPRPWEDPDFLQG |
| GG..G.................DPEL.K.RLK..KI..ESE..KIKD.TFDD.KNIRG.R.WEDPD.LQG | |
| Retrocopy | GGDRGVKTHAKTESHRSRMRQTDPELDK>RLKVSKIP*ESESKKIKDLTFDDGKNIRGFRHWEDPDLLQG |
| Parental | RNPEILKTKTT |
| .N..ILKTK.T | |
| Retrocopy | *NLKILKTKAT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000133983 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011089 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001776 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028663 | 1 retrocopy |
retro_ogar_3045 ,
|
| Pongo abelii | ENSPPYG00000005951 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000006494 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047115 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013313 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014791 | 1 retrocopy |