RetrogeneDB ID: | retro_mmul_1507 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 2:40535513..40535756(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDK2AP1 | ||
| Ensembl ID: | ENSMMUG00000000434 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 84.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | SQYRQLLSDYGPPSLGYTQGTGNSQV-PQSKYAELLAIIEELGK-EIRPTYAGSKSAMERLKRGIIHARG |
| SQY.QLLSDY.PPSLGYTQGTGNSQV.PQS..A.LLAII.ELG...IRPTY.GSKS...R.K...IHA.G | |
| Retrocopy | SQYHQLLSDYRPPSLGYTQGTGNSQV>PQSRCAKLLAIIQELGE<VIRPTYTGSKSTVKRPKQVTIHAKG |
| Parental | LVRECLAETERNA |
| LV.E.L..TE.NA | |
| Retrocopy | LVWEWLVKTEWNA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 50 .09 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 40 .06 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 52 .69 RPM |
| SRP007412_heart | 0 .00 RPM | 39 .04 RPM |
| SRP007412_kidney | 0 .00 RPM | 25 .94 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .81 RPM |
| SRP007412_testis | 0 .00 RPM | 41 .76 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2834 |
| Pan troglodytes | retro_ptro_1921 |
| Gorilla gorilla | retro_ggor_1968 |
| Pongo abelii | retro_pabe_2198 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015147 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000010939 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009567 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000009438 | 12 retrocopies | |
| Macaca mulatta | ENSMMUG00000000434 | 1 retrocopy |
retro_mmul_1507 ,
|
| Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
| Monodelphis domestica | ENSMODG00000012451 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029394 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000001070 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015009 | 1 retrocopy |