RetrogeneDB ID: | retro_mmul_1507 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 2:40535513..40535756(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CDK2AP1 | ||
Ensembl ID: | ENSMMUG00000000434 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.08 % |
Parental protein coverage: | 84.38 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SQYRQLLSDYGPPSLGYTQGTGNSQV-PQSKYAELLAIIEELGK-EIRPTYAGSKSAMERLKRGIIHARG |
SQY.QLLSDY.PPSLGYTQGTGNSQV.PQS..A.LLAII.ELG...IRPTY.GSKS...R.K...IHA.G | |
Retrocopy | SQYHQLLSDYRPPSLGYTQGTGNSQV>PQSRCAKLLAIIQELGE<VIRPTYTGSKSTVKRPKQVTIHAKG |
Parental | LVRECLAETERNA |
LV.E.L..TE.NA | |
Retrocopy | LVWEWLVKTEWNA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 50 .09 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 40 .06 RPM |
SRP007412_cerebellum | 0 .00 RPM | 52 .69 RPM |
SRP007412_heart | 0 .00 RPM | 39 .04 RPM |
SRP007412_kidney | 0 .00 RPM | 25 .94 RPM |
SRP007412_liver | 0 .00 RPM | 13 .81 RPM |
SRP007412_testis | 0 .00 RPM | 41 .76 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2834 |
Pan troglodytes | retro_ptro_1921 |
Gorilla gorilla | retro_ggor_1968 |
Pongo abelii | retro_pabe_2198 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015147 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000010939 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009567 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000009438 | 12 retrocopies | |
Macaca mulatta | ENSMMUG00000000434 | 1 retrocopy |
retro_mmul_1507 ,
|
Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
Monodelphis domestica | ENSMODG00000012451 | 2 retrocopies | |
Mus musculus | ENSMUSG00000029394 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000001070 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000015009 | 1 retrocopy |