RetrogeneDB ID: | retro_mmul_2107 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:122235537..122235907(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C1orf146 | ||
| Ensembl ID: | ENSMMUG00000010094 | ||
| Aliases: | None | ||
| Description: | chromosome 1 open reading frame 146 [Source:HGNC Symbol;Acc:24032] |
| Percent Identity: | 57.48 % |
| Parental protein coverage: | 69.44 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected: | 2 |
| Parental | YEVATALENRSHKVRYSDS-VENGSIIFSLSGVAFLLMDTKECI-LSTEETLLAKIEKFINIHQNSFLVL |
| YEV..ALEN.SHK...S....ENGSIIF..S.VAF.LMD.KEC.....E...LAK.EKFINIH.N.FL.L | |
| Retrocopy | YEVVAALEN*SHKF**SNK<MENGSIIFPFSAVAF*LMDAKECL<MLAEAIFLAKYEKFINIH*NNFLNL |
| Parental | SAALHGPEEWKLMFRIQQRFLGRNLRILPVHNTVNAINLMCTIAKTTSKPYIDSICY |
| S.AL.G.E.W.L...I.QRFL..NL.I......VN.INL..TIAKTT......SICY | |
| Retrocopy | SVALYGLEKWELL-SIWQRFLSSNLQIVSA*YIVNVINLVHTIAKTTLYRNMNSICY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 2 .24 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .40 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .42 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .08 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .66 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3381 |
| Pan troglodytes | retro_ptro_2298 |
| Gorilla gorilla | retro_ggor_2289 |
| Pongo abelii | retro_pabe_2780 |
| Callithrix jacchus | retro_cjac_1817 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000027936 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004012 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017547 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003083 | 1 retrocopy | |
| Homo sapiens | ENSG00000203910 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006653 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000013311 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016984 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010094 | 1 retrocopy |
retro_mmul_2107 ,
|
| Nomascus leucogenys | ENSNLEG00000010426 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001156 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000030530 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012506 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014426 | 1 retrocopy |