RetrogeneDB ID: | retro_nleu_1275 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397287.1:12520305..12520544(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSNLEG00000005584 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 61.73 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAL-EQTEEYVNGQLKNKYGDAFIRGNN |
M.L.KQT.S.FLK.II.R.V.VKLN..V.Y.G.LACLD...NIAL.E..EEY..GQ.K.KYG.AF..GN. | |
Retrocopy | MNLWKQTSSAFLKHIIRRQVMVKLNPRVNY*GDLACLDDCLNIAL<EKAEEYISGQPKTKYGYAFV*GNS |
Parental | VLYISTQKRRM |
...ISTQ.RRM | |
Retrocopy | MSHISTQERRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Homo sapiens | ENSG00000164167 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies |
retro_nleu_1275 , retro_nleu_1479,
|
Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |