RetrogeneDB ID: | retro_ggor_1638 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:60643227..60643466(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSGGOG00000001310 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.14 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAL-EQTEEYVNGQLKNKYGDAFIRGNN |
M.L.KQT.S.FLK.II.RPVVVKLN.GV.Y.G.LACLD...NIAL.E..EEY..GQ.K.KYG.AF..GNN | |
Retrocopy | MNLWKQTSSAFLKHIIRRPVVVKLNPGVNY*GDLACLDDCSNIAL<EKAEEYISGQPKTKYGYAFV*GNN |
Parental | VLYISTQKRRM |
VL.ISTQ.RRM | |
Retrocopy | VLHISTQERRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .73 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .18 RPM |
SRP007412_heart | 0 .00 RPM | 3 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 7 .40 RPM |
SRP007412_liver | 0 .00 RPM | 8 .60 RPM |
SRP007412_testis | 0 .10 RPM | 13 .57 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2107 |
Pan troglodytes | retro_ptro_1545 |
Pongo abelii | retro_pabe_1994 |
Macaca mulatta | retro_mmul_991 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Homo sapiens | ENSG00000164167 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies |
retro_ggor_1417, retro_ggor_1638 ,
|
Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |