RetrogeneDB ID: | retro_nleu_1337 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397289.1:10967279..10967510(-) | ||
Located in intron of: | ENSNLEG00000003566 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C10ORF57 | ||
Ensembl ID: | ENSNLEG00000010657 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 61.04 % |
Parental protein coverage: | 62.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ATAAGAAYFQRGSLFWFTVITLSFGYYTWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTLLRNGYWLAWLI |
A..A.A.YF.........V..L.....TWVVFWP.SI.YQ.LGPL..FTQYLV.HHHT.L..GYWLAWL. | |
Retrocopy | ASSAAATYFCPARPLPLLVTVLGLDCFTWVVFWPWSILYQSLGPLDSFTQYLVGHHHTILCSGYWLAWLS |
Parental | HVGESLY |
HVGESLY | |
Retrocopy | HVGESLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012986 | 4 retrocopies | |
Bos taurus | ENSBTAG00000001656 | 1 retrocopy | |
Homo sapiens | ENSG00000133678 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000003613 | 2 retrocopies | |
Mus musculus | ENSMUSG00000072676 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010657 | 1 retrocopy |
retro_nleu_1337 ,
|
Oryctolagus cuniculus | ENSOCUG00000013679 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028898 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000002293 | 1 retrocopy |