RetrogeneDB ID: | retro_pabe_1393 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 16:45765479..45765710(-) | ||
Located in intron of: | ENSPPYG00000007410 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C10orf57 | ||
Ensembl ID: | ENSPPYG00000002293 | ||
Aliases: | TMEM254, C10orf57 | ||
Description: | Transmembrane protein C10orf57 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5R9A6] |
Percent Identity: | 63.64 % |
Parental protein coverage: | 62.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ATAAGAAYFQRGSLFWFTVITLSFGYYTWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLI |
A..A.A.YF.........V..L.....TWVVFWP.SI.YQ.LGPL..FTQYLV.HHHTLLC.GYWLAWL. | |
Retrocopy | ASSAAATYFCPARPLPLLVTVLGLDCFTWVVFWPWSILYQSLGPLDSFTQYLVGHHHTLLCSGYWLAWLN |
Parental | HVGESLY |
HVGESLY | |
Retrocopy | HVGESLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .00 RPM |
SRP007412_cerebellum | 0 .12 RPM | 7 .17 RPM |
SRP007412_heart | 0 .03 RPM | 1 .99 RPM |
SRP007412_kidney | 0 .07 RPM | 8 .42 RPM |
SRP007412_liver | 0 .06 RPM | 10 .10 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012986 | 4 retrocopies | |
Bos taurus | ENSBTAG00000001656 | 1 retrocopy | |
Homo sapiens | ENSG00000133678 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000003613 | 2 retrocopies | |
Mus musculus | ENSMUSG00000072676 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010657 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000013679 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028898 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000002293 | 1 retrocopy |
retro_pabe_1393 ,
|