RetrogeneDB ID: | retro_nleu_2790 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397431.1:1466643..1466888(+) | ||
| Located in intron of: | ENSNLEG00000007820 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM32A | ||
| Ensembl ID: | ENSNLEG00000005441 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.13 % |
| Parental protein coverage: | 73.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE |
| ..AYEQVQKG.LK.KGVAEL.VTK.KKK.KDKDKAKLLEAMG..K.NEEEK..GLDK.TPAQAAFEKMQE | |
| Retrocopy | VDAYEQVQKGLLKPKGVAELRVTKWKKKNKDKDKAKLLEAMGMNKNNEEEKQHGLDKWTPAQAAFEKMQE |
| Parental | KRQ-MERILKKAS |
| KRQ.MERILKKAS | |
| Retrocopy | KRQ<MERILKKAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
| Homo sapiens | ENSG00000105058 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies |
retro_nleu_192, retro_nleu_2227, retro_nleu_2790 ,
|
| Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |