RetrogeneDB ID: | retro_ptro_1304 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 18:63907764..63908004(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM32A | ||
Ensembl ID: | ENSPTRG00000010641 | ||
Aliases: | None | ||
Description: | family with sequence similarity 32, member A [Source:HGNC Symbol;Acc:24563] |
Percent Identity: | 57.5 % |
Parental protein coverage: | 71.43 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRH |
...KKDKD..KL.E..G.SK.N.EEKR..LDK.T..Q.A.EKMQEK.QMER....AS..H.Q.VEDFN.. | |
Retrocopy | RREKKDKDVVKLSEMVGMSKNNREEKRCSLDKCTLTQEA*EKMQEKQQMERFQEEASTMHQQSVEDFNTQ |
Parental | LDTLTEHYDI |
LDTL.E.... | |
Retrocopy | LDTLRERIQV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 49 .30 RPM |
SRP007412_cerebellum | 0 .00 RPM | 41 .48 RPM |
SRP007412_heart | 0 .00 RPM | 22 .33 RPM |
SRP007412_kidney | 0 .00 RPM | 73 .12 RPM |
SRP007412_liver | 0 .00 RPM | 56 .99 RPM |
SRP007412_testis | 0 .21 RPM | 18 .23 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1950 |
Gorilla gorilla | retro_ggor_1420 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
Homo sapiens | ENSG00000105058 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |