RetrogeneDB ID: | retro_sscr_870 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:55842091..55842427(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM32A | ||
| Ensembl ID: | ENSSSCG00000013855 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 32, member A [Source:HGNC Symbol;Acc:24563] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MEDYEQVQRGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE |
| ME..E.VQ.GP.KLKG..EL....RKKKKK.KDKAKL.E.MGT.....EEK..GLD..TPAQ.AFEKMQE | |
| Retrocopy | MEAHEHVQQGPPKLKGGPELRAIRRKKKKKAKDKAKLPEGMGTIRRDKEEKPPGLDVGTPAQVAFEKMQE |
| Parental | KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK |
| .RQ.ERI.KKAS.TH.QRVEDFNRHLDTLTE..D.PKVSWTK | |
| Retrocopy | ERQGERIPKKASRTHRQRVEDFNRHLDTLTEYFDLPKVSWTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 24 .29 RPM |
| SRP014902_testis | 0 .00 RPM | 24 .89 RPM |
| SRP018288_heart | 0 .00 RPM | 34 .94 RPM |
| SRP018288_kidney | 0 .00 RPM | 70 .63 RPM |
| SRP018288_liver | 0 .00 RPM | 44 .61 RPM |
| SRP018288_lung | 0 .00 RPM | 59 .98 RPM |
| SRP018856_adipose | 0 .00 RPM | 90 .31 RPM |
| SRP035408_brain | 0 .00 RPM | 132 .50 RPM |
| SRP035408_liver | 0 .00 RPM | 76 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
| Homo sapiens | ENSG00000105058 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013855 | 2 retrocopies |
retro_sscr_292, retro_sscr_870 ,
|
| Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |