RetrogeneDB ID: | retro_ogar_2003 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873579.1:11410799..11411041(-) | ||
| Located in intron of: | ENSOGAG00000006430 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RNF11 | ||
| Ensembl ID: | ENSOGAG00000011682 | ||
| Aliases: | None | ||
| Description: | ring finger protein 11 [Source:HGNC Symbol;Acc:10056] |
| Percent Identity: | 71.95 % |
| Parental protein coverage: | 52.6 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | IGVIIHLPRAPFEPSSSGVFKIIHLCVICMMDFVYGDPIRFLPCMHIYHLDCIDD-WLMRSFTCPSCMEP |
| IG.I.HLP.....P...G..K.I..C.ICMMDFVY.D.I.FLPCMHIYHLDCIDD.WLMRSFTC.SCM.P | |
| Retrocopy | IGLIQHLPKGVYDPGRDGSEKMIRECMICMMDFVYRDLI*FLPCMHIYHLDCIDD<WLMRSFTCVSCMKP |
| Parental | VDAALLSSYETN |
| VDAA.LSSYETN | |
| Retrocopy | VDAAVLSSYETN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000006072 | 1 retrocopy | |
| Homo sapiens | ENSG00000123091 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004919 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004439 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011682 | 1 retrocopy |
retro_ogar_2003 ,
|
| Pongo abelii | ENSPPYG00000001361 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000041089 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020072 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010211 | 1 retrocopy |