RetrogeneDB ID: | retro_opri_228 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | GeneScaffold_3844:483509..483716(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBL5 | ||
Ensembl ID: | ENSOPRG00000013412 | ||
Aliases: | None | ||
Description: | ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736] |
Percent Identity: | 72.6 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MIEVVC-DRLGK-VRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL |
M.EVVC.DRLGK.V.VKCNT.DTIGDLK.LIA.QT.TRWNK.VLK....IFK.H...GDY..HDG.NLEL | |
Retrocopy | MMEVVCNDRLGKKVWVKCNTKDTIGDLK*LIASQTNTRWNKTVLK----IFKAHILMGDYKVHDGLNLEL |
Parental | YYQ |
YYQ | |
Retrocopy | YYQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012371 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000032630 | 5 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
Dipodomys ordii | ENSDORG00000006499 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000029004 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000013412 | 2 retrocopies |
retro_opri_228 , retro_opri_687,
|
Rattus norvegicus | ENSRNOG00000020442 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000005286 | 1 retrocopy |