RetrogeneDB ID: | retro_pabe_1353 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 16:38161030..38161417(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SOD1 | ||
Ensembl ID: | ENSPPYG00000011354 | ||
Aliases: | None | ||
Description: | superoxide dismutase [Source:RefSeq peptide;Acc:NP_001125441] |
Percent Identity: | 62.41 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | ERNGPVKVWGSIEGLTEGLHGFHVHEFGDNTVGCTSAGPHFNPLSRKHGGP-KDEERHVGDLGNVTADKD |
..N.P..V...I.GLTE..H.FHVH.FGDNT.GCT.AGP.FNPL...H.GP.KD.ER.VGDLGNV...KD | |
Retrocopy | KENEPFMVSECITGLTECQHRFHVHKFGDNTPGCTRAGPYFNPLTKNHSGP<KDQERQVGDLGNVASGKD |
Parental | -GVASVSIEDSVISLSGDHCIIGRTLV-VHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
..V..VS.EDS..SLSG...I...T.V.VH.K..DLGKG.NEEST.TGNA.S.L.CG.IGIAQ | |
Retrocopy | <CVTNVSVEDSLVSLSGHYSITAHTMV<VHDKPNDLGKGENEESTNTGNARSCLVCGIIGIAQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 171 .01 RPM |
SRP007412_cerebellum | 0 .00 RPM | 163 .80 RPM |
SRP007412_heart | 0 .00 RPM | 115 .27 RPM |
SRP007412_kidney | 0 .00 RPM | 350 .86 RPM |
SRP007412_liver | 0 .00 RPM | 396 .11 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1637 |
Pan troglodytes | retro_ptro_1107 |
Gorilla gorilla | retro_ggor_1238 |
Macaca mulatta | retro_mmul_1563 |
Callithrix jacchus | retro_cjac_1986 |